PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_FFCC35B9C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family VOZ
Protein Properties Length: 583aa    MW: 63588.9 Da    PI: 5.1563
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_FFCC35B9C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ410.72.8e-1262504671217
                    VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatak 87 
                            p+ps++lgpkcalwdc rp++gse++qdyc+ +ha lal + gl+gt+pv+rp+gidlkdg+lf+al akvqgk+vgip+cegaat+k
  Traes_1AL_FFCC35B9C.1 250 PSPSQYLGPKCALWDCGRPVRGSEECQDYCNPYHAGLALSDdGLLGTRPVMRPRGIDLKDGPLFDALCAKVQGKNVGIPVCEGAATSK 337
                            89*************************************87699******************************************** PP

                    VOZ  88 spwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyein 175
                            spwna elfdlsllege++rewlffd+prrafesgnrkqrslpdy+grgwhesrkqvmk+fgglk+syymdpqpss++ewhl+eyein
  Traes_1AL_FFCC35B9C.1 338 SPWNAHELFDLSLLEGESLREWLFFDRPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKKSYYMDPQPSSNYEWHLFEYEIN 425
                            **************************************************************************************** PP

                    VOZ 176 eldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                            ++++lalyrle+k +d k+s+k+k+ ++sl+++q+++++l+a
  Traes_1AL_FFCC35B9C.1 426 DSNTLALYRLEFKASDPKRSVKSKLGSSSLNEIQQQMVKLSA 467
                            ****************************************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MAGDPTGGGG GSAAGKGPRS STRHQQFRDR AKTRVDDLQE IFSGLQSARK ESRSADAAVL  60
EEQVHQMLRE WRAELSVASP ASSLQNSLGN NQGAADPPSE TLRLLQLAIE EEDDATSKLA  120
QPMQPSRQDG HQNLNPGLQV HGGTVDGGAD ASQQSMGHGM QGELADVANA LFSDQMYYID  180
HELSIDDFLH GSNPDGLNNL QGTGQPEHQQ FNLPLDLQHS NNSYADANNS VQSTGDVFFH  240
MSDLLTTVGP SPSQYLGPKC ALWDCGRPVR GSEECQDYCN PYHAGLALSD DGLLGTRPVM  300
RPRGIDLKDG PLFDALCAKV QGKNVGIPVC EGAATSKSPW NAHELFDLSL LEGESLREWL  360
FFDRPRRAFE SGNRKQRSLP DYNGRGWHES RKQVMKDFGG LKKSYYMDPQ PSSNYEWHLF  420
EYEINDSNTL ALYRLEFKAS DPKRSVKSKL GSSSLNEIQQ QMVKLSANSP VDNKRGARSK  480
TKASQKDTNA NAYPALKATN QAGASNAYEA VPLNIPNQAS APSAYQTVAP NIPNQDSTSN  540
AYEDASQVDP MSYLNENVVY GPHLPYGYPD GKGDFYWNPS GGA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3762940.0AK376294.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3120B09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568104.10.0PREDICTED: transcription factor VOZ1-like
TrEMBLW4ZUI80.0W4ZUI8_WHEAT; Uncharacterized protein
STRINGBRADI2G19820.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-139vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]